PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 387aa    MW: 43996.4 Da    PI: 6.1155
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019089genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.31.1e-24953145
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                 kr en+snrqvt+skRr+gilKKA+ELS+LCd+++++++fs+tg+
  Lus10019089  9 KRLENTSNRQVTYSKRRHGILKKAKELSILCDIDILLLMFSPTGR 53
                 789****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.226161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-27294IPR002100Transcription factor, MADS-box
CDDcd002662.70E-29283No hitNo description
PRINTSPR004047.2E-20323IPR002100Transcription factor, MADS-box
PfamPF003198.4E-211156IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGRVKLKIKR LENTSNRQVT YSKRRHGILK KAKELSILCD IDILLLMFSP TGRPTLFNGE  60
RGIEDVIAKF AQLTPQDRAK RKMESLETLK KTFKKLDHDV NIQAFFGARG QTVEEVTDQV  120
RLMQAEVTEL DRRLSYWMDP EKIDSIEQIQ QMEASIRESL SRISLHKENI KNHQLMSLDC  180
SSQFQNGLQL PLMMNGLHNT NSLSWLVNNG NQNFVLTNEP NALHHSSMMH NYKDDHRDME  240
CSTESSAPGC HGFFSSEKQP EIGNPALMDN MGQQAGHFNE LGSSSRLNLQ LGEQFPYHGY  300
GSLCLAADDK KFELQMGNNL NENHNVYEVN NNNEVEIPRP MYEDGHNNWI PAVDGPSGVA  360
ILDQNPPYPQ VQEPHFSYSE CYSANN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-14191190Myocyte-specific enhancer factor 2B
1tqe_Q2e-14191190Myocyte-specific enhancer factor 2B
1tqe_R2e-14191190Myocyte-specific enhancer factor 2B
1tqe_S2e-14191190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572064.11e-150PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
SwissprotQ7X9I05e-91AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLB9RLX31e-148B9RLX3_RICCO; Mads box protein, putative
STRINGVIT_17s0000g06340.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-81AGAMOUS-like 65